PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00678.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 532aa    MW: 59842.7 Da    PI: 5.9827
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00678.1_g00006.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.21.4e-083333701954
                              HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              Fe   ++yp+ +++  LA+++gL+  qV++WF N R +
  Rsa1.0_00678.1_g00006.1 333 FEHflHPYPKDSDKIMLARQTGLSRGQVSNWFINARVR 370
                              664459******************************88 PP

2BELL125.52e-40200271172
                     BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                              e+qe+++k +kLls+l+eVd+rYkqy++q+q+v+ssF+++ag+g+akpYt+lAl++iSrhFr+L+dai++qi
  Rsa1.0_00678.1_g00006.1 200 EKQEMHNKLTKLLSMLDEVDRRYKQYYQQMQIVVSSFDVIAGYGAAKPYTALALQTISRHFRSLRDAISGQI 271
                              689********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.1E-71135269IPR006563POX domain
PfamPF075261.7E-48141268IPR006563POX domain
PROSITE profilePS5007111.758311374IPR001356Homeobox domain
CDDcd000862.98E-11314375No hitNo description
SMARTSM003891.0E-8314378IPR001356Homeobox domain
SuperFamilySSF466891.54E-16315380IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-26317379IPR009057Homeodomain-like
PfamPF059201.0E-17331370IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MENYQEARFP PGNAMIHMNP TVSYSEEVAG RESTEANNVS ASQERQVYSR FGGVSQMQDI  60
QDFGSWRDQA SDRSGFHLMS PIAVPTGVHQ TGQGLSLSLG SQILPAIHQM NHQRMEPREE  120
HCRGNEYATQ SFPNVDVVRT IPNSKYLKAA QQLLDEAVNV KKSLKQFQPE GDKNKENPQE  180
PDQTPQDSST NPPAEISQSE KQEMHNKLTK LLSMLDEVDR RYKQYYQQMQ IVVSSFDVIA  240
GYGAAKPYTA LALQTISRHF RSLRDAISGQ IIVIRKCLGE QDGSDGKGVG VISRLKYVDQ  300
HLRQQRGFMQ PQAWRPQRGL PENSVLILRA WLFEHFLHPY PKDSDKIMLA RQTGLSRGQV  360
SNWFINARVR LWKPMVEEIY KEEFTENDSN SSSENTPKMS EVRPIVADDE DPAQEFPQDR  420
TKPDHEHGYG VETCGMVQGG HQMDGGRFMT VEPSYHVAEI SRFGGGGVSL TLGLQNSQGR  480
ENVVAMSSEA YNSFPGVGIY GNDIPGAEME YVNPESRQNR ISSSQLVHDF VA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A9e-15320378563Homeobox protein Meis2
3k2a_B9e-15320378563Homeobox protein Meis2
4xrm_A1e-14320378563Homeobox protein Meis2
4xrm_B1e-14320378563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3531440.0AK353144.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-17-H08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009138307.10.0PREDICTED: BEL1-like homeodomain protein 6
RefseqXP_009138308.10.0PREDICTED: BEL1-like homeodomain protein 6
RefseqXP_009138309.10.0PREDICTED: BEL1-like homeodomain protein 6
SwissprotO656850.0BLH6_ARATH; BEL1-like homeodomain protein 6
TrEMBLM4DMD30.0M4DMD3_BRARP; Uncharacterized protein
STRINGBra017666.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28692563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.20.0BEL1-like homeodomain 6